Request QuoteCatalog Number: xP340875EDOSize: 0.2-1mg

Request Quote

Recombinant Protein P16 (XVI)

Recombinant Protein P16 (XVI) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340875EDOYeast1mgQuote
EP340875EDOE. coli1mgQuote
BP340875EDOBaculovirus200ugQuote
MP340875EDOMammalian Cell200ugQuote

Protein Information

SpeciesEnterobacteria phage PRD1 (Bacteriophage PRD1)
UniProt IDP27392
Gene NameXVI; aka: S
Protein NameProtein P16
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMDKKKLLYWVGGGLVLILIWLWFRNRPAAQVASNWEGPPYMTYNQPQAGSVTLPVAGYTS PSPTLPNRNRSCGCNPAVSAAMAQGADLASKLTDSITSQLNDYASSLNDYLASQAGV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review