Request QuoteCatalog Number: xP014638HOSize: 0.2-1mg

Request Quote

Recombinant Promotilin (MLN)

Recombinant Promotilin (MLN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP014638HOYeast1mgQuote
EP014638HOE. coli1mgQuote
BP014638HOBaculovirus200ugQuote
MP014638HOMammalian Cell200ugQuote

Protein Information

SpeciesEquus caballus (Horse)
UniProt IDO46617
Gene NameMLN
Protein NamePromotilin Cleaved into the following 2 chains: 1. Motilin 2. Motilin-associated peptide
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceFVPIFTYSELQRMQEKERNRGQKKSLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEI GMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review