Request QuoteCatalog Number: xP018744HUSize: 0.2-1mg

Request Quote

Recombinant Proline dehydrogenase 1, mitochondrial (PRODH)

Recombinant Proline dehydrogenase 1, mitochondrial (PRODH) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP018744HUYeast1mgQuote
EP018744HUE. coli1mgRPC755Hu01
BP018744HUBaculovirus200ugQuote
MP018744HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO43272
Gene NamePRODH; aka: PIG6, POX2
Protein NameProline dehydrogenase 1, mitochondrial
Region Expressed1-108
Expression Tag6xHis
Purity>90%
AA SequenceMALRRALPALRPCIPRFVQLSTAPASREQPAAGPAAVPGGGSATAVRPPVPAVDFGNAQE AYRSRRTWELARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review