Request QuoteCatalog Number: xP518633SXVSize: 0.2-1mg

Request Quote

Recombinant Probable small nuclear ribonucleoprotein Sm D1 (smd1)

Recombinant Probable small nuclear ribonucleoprotein Sm D1 (smd1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518633SXVYeast1mgQuote
EP518633SXVE. coli1mgQuote
BP518633SXVBaculovirus200ugQuote
MP518633SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO42661
Gene Namesmd1; ORFs:SPAC27D7.07c
Protein NameProbable small nuclear ribonucleoprotein Sm D1
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMKLVRFLMKLTNETVSIELKNGTIVHGTITSVDMQMNTHLKAVKMTVKGREPVPVETLSI RGNNIRYYILPDSLPLDTLLIDDSTKPKQKKKEVVRGRGRGRGRGTRGRGRGASRGF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review