Request QuoteCatalog Number: xP525013CXYSize: 0.2-1mg

Request Quote

Recombinant Probable signal peptidase complex subunit 1 (C34B2.10)

Recombinant Probable signal peptidase complex subunit 1 (C34B2.10) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP525013CXYYeast1mgQuote
EP525013CXYE. coli1mgQuote
BP525013CXYBaculovirus200ugQuote
MP525013CXYMammalian Cell200ugQuote

Protein Information

SpeciesCaenorhabditis elegans
UniProt IDO44953
Gene NameORFs:C34B2.10
Protein NameProbable signal peptidase complex subunit 1
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMDGMIAMLPAPLQKLSSHIDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVL GASAFTALIILPPWPFLFRKNPIVWHTPAEPQESGDKKKETKKTK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review