Request QuoteCatalog Number: xP340858HNOSize: 0.2-1mg

Request Quote

Recombinant Probable protein E5 (E5)

Recombinant Probable protein E5 (E5) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340858HNOYeast1mgQuote
EP340858HNOE. coli1mgQuote
BP340858HNOBaculovirus200ugQuote
MP340858HNOMammalian Cell200ugQuote

Protein Information

SpeciesHuman papillomavirus type 42
UniProt IDP27227
Gene NameE5
Protein NameProbable protein E5
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceTVIGLQYCDSTTCGTTGQKLLLLLFIVVGACVVCVWISLQNYPYPVWASCLASYLTLVLL SWLQVLTYFDYFFLCLIILGIPSVLLTLLIHLAIQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review