Request QuoteCatalog Number: xP523686CXYSize: 0.2-1mg

Request Quote

Recombinant Probable 5-hydroxyisourate hydrolase ZK697.8 (ZK697.8)

Recombinant Probable 5-hydroxyisourate hydrolase ZK697.8 (ZK697.8) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP523686CXYYeast1mgQuote
EP523686CXYE. coli1mgQuote
BP523686CXYBaculovirus200ugQuote
MP523686CXYMammalian Cell200ugQuote

Protein Information

SpeciesCaenorhabditis elegans
UniProt IDO44578
Gene NameORFs:ZK697.8
Protein NameProbable 5-hydroxyisourate hydrolase ZK697.8
Region Expressed20-136
Expression Tag6xHis
Purity>90%
AA SequenceELAVPTASISAHVLDISGGSPAGGIQILAFILLNNGWTNIGSQFTQDNGRVDWVSPDFTL IPGTYRLVYITEPYYTAKNVESFYPYVEVVFNIRNATQHYHVPLTLSPWGYSTYRGS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review