Request QuoteCatalog Number: xP017708RASize: 0.2-1mg

Request Quote

Recombinant Platelet-derived growth factor subunit A (Pdgfa)

Recombinant Platelet-derived growth factor subunit A (Pdgfa) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP017708RAYeast1mgQuote
EP017708RAE. coli1mgRPA523Ra01
BP017708RABaculovirus200ugQuote
MP017708RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP28576
Gene NamePdgfa; aka: Rpa1
Protein NamePlatelet-derived growth factor subunit A
Region Expressed86-204
Expression Tag6xHis
Purity>90%
AA SequenceRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRV HHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review