Request QuoteCatalog Number: xP008692RASize: 0.2-1mg

Request Quote

Recombinant Peptidyl-prolyl cis-trans isomerase FKBP1B (Fkbp1b)

Recombinant Peptidyl-prolyl cis-trans isomerase FKBP1B (Fkbp1b) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP008692RAYeast1mgQuote
EP008692RAE. coli1mgQuote
BP008692RABaculovirus200ugQuote
MP008692RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP97534
Gene NameFkbp1b
Protein NamePeptidyl-prolyl cis-trans isomerase FKBP1B
Region Expressed2-108
Expression Tag6xHis
Purity>90%
AA SequenceGVEIETISPGDGRTFPKKGQICVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFE EGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review