Request QuoteCatalog Number: xP008698MOSize: 0.2-1mg

Request Quote

Recombinant Peptidyl-prolyl cis-trans isomerase FKBP2 (Fkbp2)

Recombinant Peptidyl-prolyl cis-trans isomerase FKBP2 (Fkbp2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP008698MOYeast1mgQuote
EP008698MOE. coli1mgQuote
BP008698MOBaculovirus200ugQuote
MP008698MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP45878
Gene NameFkbp2; aka: Fkbp13
Protein NamePeptidyl-prolyl cis-trans isomerase FKBP2
Region Expressed23-140
Expression Tag6xHis
Purity>90%
AA SequenceAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQ VIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review