Request QuoteCatalog Number: xP331792CHSize: 0.2-1mg

Request Quote

Recombinant Parvalbumin, thymic CPV3

Recombinant Parvalbumin, thymic CPV3 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP331792CHYeast1mgQuote
EP331792CHE. coli1mgQuote
BP331792CHBaculovirus200ugQuote
MP331792CHMammalian Cell200ugQuote

Protein Information

SpeciesGallus gallus (Chicken)
UniProt IDP43305
Gene Name
Protein NameParvalbumin, thymic CPV3
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMSLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIE EDELKYFLQRFECGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review