Request QuoteCatalog Number: xP514919SVLSize: 0.2-1mg

Request Quote

Recombinant Outer spore wall protein 5 (OSW5)

Recombinant Outer spore wall protein 5 (OSW5) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514919SVLYeast1mgQuote
EP514919SVLE. coli1mgQuote
BP514919SVLBaculovirus200ugQuote
MP514919SVLMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain JAY291) (Baker's yeast)
UniProt IDC7GQ88
Gene NameOSW5; ORFs:C1Q_02484
Protein NameOuter spore wall protein 5
Region Expressed51-148
Expression Tag6xHis
Purity>90%
AA SequenceSFKMAQLIYVRADAFLKKVLDKMALQTQPAQLQEPQEPLSTLRPVSNPTIPSPLRQTARP SKFVTEEDVIFEPVSAQSAIARSLETTANKAGNKFQLS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review