Request QuoteCatalog Number: xP428140HUSize: 0.2-1mg

Request Quote

Recombinant Oocyte-secreted protein 1 homolog (OOSP1)

Recombinant Oocyte-secreted protein 1 homolog (OOSP1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP428140HUYeast1mgQuote
EP428140HUE. coli1mgQuote
BP428140HUBaculovirus200ugQuote
MP428140HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA8MZH6
Gene NameOOSP1
Protein NameOocyte-secreted protein 1 homolog
Region Expressed27-123
Expression Tag6xHis
Purity>90%
AA SequenceIQVHCTQFWFFARIKPTIFYNLYVNPDEVFLGDGCHVTHVLPNVYYEFFYHPHDCGIVTQ PLQEVLLLKTKIRYISRDSTVRSEMPLSCVVHKQKCQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review