Request QuoteCatalog Number: xP341015MKGSize: 0.2-1mg

Request Quote

Recombinant Non-structural protein 1 (1C)

Recombinant Non-structural protein 1 (1C) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP341015MKGYeast1mgQuote
EP341015MKGE. coli1mgQuote
BP341015MKGBaculovirus200ugQuote
MP341015MKGMammalian Cell200ugQuote

Protein Information

SpeciesMurine pneumonia virus (strain 15) (MPV)
UniProt IDP28888
Gene Name1C; aka: NS1
Protein NameNon-structural protein 1
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMGCNVMMELDYGGRAAWLAFHITNFDRSDLETILRGARVCNTWQDQRLSVYLVGRDCNLL RPFVQAAKFIHNTRRGQTLTHWFTKNIVFSSTGQETEPPIDPTCELLVELISG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review