MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD
PGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKG
LEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRF
WPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQR
CGWIPIQYPIISECKCSC.

The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 1-2ng/ml of NOGGIN corresponding to a specific activity of 0.5-1MIU/mg.

Lyophilized from a 0.2um filtered solution in 30% CH3CN, 0.1% TFA.

Sterile Filtered White lyophilized (freeze-dried) powder.

Greater than 95.0% as determined by SDS-PAGE.

It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.

Escherichia Coli.

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18^oC. Upon reconstitution Mouse Noggin should be stored at 4^oC between 2-7 days and for future use below -18^oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Noggin, SYM1, SYNS1, NOG.