Request QuoteCatalog Number: xP016021SHSize: 0.2-1mg

Request Quote

Recombinant Natriuretic peptides B (NPPB)

Recombinant Natriuretic peptides B (NPPB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP016021SHYeast1mgQuote
EP016021SHE. coli1mgQuote
BP016021SHBaculovirus200ugQuote
MP016021SHMammalian Cell200ugQuote

Protein Information

SpeciesOvis aries (Sheep)
UniProt IDO46541
Gene NameNPPB
Protein NameNatriuretic peptides B
Region Expressed27-129
Expression Tag6xHis
Purity>90%
AA SequenceHPLGGPGSASELPGLQELLDRLRDRVSELQAEQLRVEPLQQGQGLEETWDSPAAAPAGFL GPHHSLLQALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review