Request QuoteCatalog Number: xP513115HUWSize: 0.2-1mg

Request Quote

Recombinant NADH-quinone oxidoreductase subunit K (nuoK)

Recombinant NADH-quinone oxidoreductase subunit K (nuoK) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513115HUWYeast1mgQuote
EP513115HUWE. coli1mgQuote
BP513115HUWBaculovirus200ugQuote
MP513115HUWMammalian Cell200ugQuote

Protein Information

SpeciesHelicobacter pylori (strain B38)
UniProt IDC7C0H5
Gene NamenuoK; Locus:HELPY_1246
Protein NameNADH-quinone oxidoreductase subunit K
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMIGLNHYLIVSGLLFCIGLAGMLKRKNILLLFFSTEIMLNAINIGFVAISRYTHNLDGQM FALFIIAIAASEVAIGLGLVILWFKKYKSLDIDSLNAMKG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review