Request QuoteCatalog Number: xP340580ENVSize: 0.2-1mg

Request Quote

Recombinant Multidrug transporter emrE (emrE)

Recombinant Multidrug transporter emrE (emrE) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340580ENVYeast1mgQuote
EP340580ENVE. coli1mgQuote
BP340580ENVBaculovirus200ugQuote
MP340580ENVMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12)
UniProt IDP23895
Gene NameemrE; aka: eb, mvrC; Locus:b0543, JW0531
Protein NameMultidrug transporter emrE
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY AIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review