Request QuoteCatalog Number: xP340869LFUSize: 0.2-1mg

Request Quote

Recombinant Movement protein TGB2 (ORF3)

Recombinant Movement protein TGB2 (ORF3) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340869LFUYeast1mgQuote
EP340869LFUE. coli1mgQuote
BP340869LFUBaculovirus200ugQuote
MP340869LFUMammalian Cell200ugQuote

Protein Information

SpeciesLily symptomless virus (LSV)
UniProt IDP27332
Gene NameORFs:ORF3
Protein NameMovement protein TGB2
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMPLTPPPDYTRVYTALAIGASIAFFTGLITRNTLPSVGDLQHNLPHGGRYRDGTKSVEYC GPRKLNSVESGSRWTFQPWLLVIVLVALIIALGRQGHNCRACGRSH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review