Request QuoteCatalog Number: xP517163DKDSize: 0.2-1mg

Request Quote

Recombinant Modulator protein MzrA (mzrA)

Recombinant Modulator protein MzrA (mzrA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517163DKDYeast1mgQuote
EP517163DKDE. coli1mgQuote
BP517163DKDBaculovirus200ugQuote
MP517163DKDMammalian Cell200ugQuote

Protein Information

SpeciesDickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937) )
UniProt IDE0SKT0
Gene NamemzrA; Locus:Dda3937_02735
Protein NameModulator protein MzrA
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMMTNRRFRKPSAWRLLLLLLPLVVLLSMSSRRLPDEVMLHITPLHQGAPLPDGFYIYQRL NERGIAIKSITPENDSIIVRLSSPEQSGAAREILSTALPYAIVIAQRSNGTSPVTRS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review