Request QuoteCatalog Number: xP007026CXYSize: 0.2-1mg

Request Quote

Recombinant Mitochondrial import inner membrane translocase subunit TIM14 (dnj-21)

Recombinant Mitochondrial import inner membrane translocase subunit TIM14 (dnj-21) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP007026CXYYeast1mgQuote
EP007026CXYE. coli1mgQuote
BP007026CXYBaculovirus200ugQuote
MP007026CXYMammalian Cell200ugQuote

Protein Information

SpeciesCaenorhabditis elegans
UniProt IDP91454
Gene Namednj-21; aka: tim-14; ORFs:T19B4.4
Protein NameMitochondrial import inner membrane translocase subunit TIM14
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMTGGLIVAGLGLAAVGFGARYVLRNQALIKKGMEAIPVAGGAFSNYYRGGFDQKMSRAEA AKILGVAPSAKPAKIKEAHKKVMIVNHPDRGGSPYLAAKINEAKDLMESSKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review