Request QuoteCatalog Number: xP529820CXYSize: 0.2-1mg

Request Quote

Recombinant Mitochondrial import inner membrane translocase subunit tim-13 (tin-13)

Recombinant Mitochondrial import inner membrane translocase subunit tim-13 (tin-13) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529820CXYYeast1mgQuote
EP529820CXYE. coli1mgQuote
BP529820CXYBaculovirus200ugQuote
MP529820CXYMammalian Cell200ugQuote

Protein Information

SpeciesCaenorhabditis elegans
UniProt IDO45319
Gene Nametin-13; aka: tim-13; ORFs:DY3.1
Protein NameMitochondrial import inner membrane translocase subunit tim-13
Region Expressed1-108
Expression Tag6xHis
Purity>90%
AA SequenceMDQLLDVETLKKLSPEQQEQVISGVKQQAALANAQNLVTDISEKCTNKCITAPGSSLASG EKQCLQRCMDRFMESWNLVSQTLQKRLQEEMASSGGMGGGFGQGPSFS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review