Request QuoteCatalog Number: xP514821ESQSize: 0.2-1mg

Request Quote

Recombinant Met repressor (metJ)

Recombinant Met repressor (metJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514821ESQYeast1mgQuote
EP514821ESQE. coli1mgQuote
BP514821ESQBaculovirus200ugQuote
MP514821ESQMammalian Cell200ugQuote

Protein Information

SpeciesPectobacterium carotovorum subsp. carotovorum (strain PC1)
UniProt IDC6DHN7
Gene NamemetJ; Locus:PC1_0176
Protein NameMet repressor
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE AFLHAFTGQPLPNDEDLRKERSDEIPEAAKIIMREMGIDPDTWEY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review