Request QuoteCatalog Number: xP522091HXKSize: 0.2-1mg

Request Quote

Recombinant Matrix M2-2 (M2-2)

Recombinant Matrix M2-2 (M2-2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522091HXKYeast1mgQuote
EP522091HXKE. coli1mgQuote
BP522091HXKBaculovirus200ugQuote
MP522091HXKMammalian Cell200ugQuote

Protein Information

SpeciesHuman respiratory syncytial virus B (strain B1)
UniProt IDO42047
Gene NameM2-2
Protein NameMatrix M2-2
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMTKPKIMILPDKYPCSISSILISSESMIATFNHKNILQFNHNHLDNHQRLLNNIFDEIHW TPKNLLDATQQFLQHLNIPEDIYTIYILVS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review