$5,928.00Catalog Number: PYT645-1mgSize: 1mg

LIF Mouse

Leukemia Inhibitory Factor Mouse Recombinant

Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.
The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.

Accession

P09056

Amino acid sequence

MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Biological Activity

Activity of murine LIF was determined by its ability to induce differentiation of murine M1myeloid leukemic cells. Min. detectable conc. of murine LIF in this specific bioassay was found to be 0.5 ng/mL. The specific activity is 100MIU/mg, where 50U is defined as the amount of murine LIF required to induce differentiation in 50% of the M1 colonies per ml of agar culture.

Formulation

Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Purity

Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility

It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source

Escherichia Coli.

Stability

Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4oC between 2-7 days and for future use below -18oC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms

CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.

Quantity

$5,928.00

ReviewsWrite Review