Request QuoteCatalog Number: xP001529HUSize: 0.2-1mg

Request Quote

Recombinant A-kinase anchor protein 7 isoforms alpha and beta (AKAP7)

Recombinant A-kinase anchor protein 7 isoforms alpha and beta (AKAP7) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001529HUYeast1mgQuote
EP001529HUE. coli1mgQuote
BP001529HUBaculovirus200ugQuote
MP001529HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO43687
Gene NameAKAP7; aka: AKAP18
Protein NameA-kinase anchor protein 7 isoforms alpha and beta
Region Expressed2-104
Expression Tag6xHis
Purity>90%
AA SequenceGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVE NAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review