Request QuoteCatalog Number: xP524352DOASize: 0.2-1mg

Request Quote

Recombinant Iron-sulfur cluster assembly protein 1 (ISU1)

Recombinant Iron-sulfur cluster assembly protein 1 (ISU1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP524352DOAYeast1mgQuote
EP524352DOAE. coli1mgQuote
BP524352DOABaculovirus200ugQuote
MP524352DOAMammalian Cell200ugQuote

Protein Information

SpeciesArabidopsis thaliana (Mouse-ear cress)
UniProt IDO49627
Gene NameISU1; Locus:At4g22220; ORFs:T10I14.50
Protein NameIron-sulfur cluster assembly protein 1
Region Expressed51-167
Expression Tag6xHis
Purity>90%
AA SequencePNVGTGLVGAPACGDVMKLQIKVDEKTGQIVDARFKTFGCGSAIASSSVATEWVKGKAME DVLTIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYKEKRVKTNGAAAAGETTQA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review