Request QuoteCatalog Number: xP513287ENUSize: 0.2-1mg

Request Quote

Recombinant Integration host factor subunit beta (ihfB)

Recombinant Integration host factor subunit beta (ihfB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513287ENUYeast1mgQuote
EP513287ENUE. coli1mgQuote
BP513287ENUBaculovirus200ugQuote
MP513287ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZQ38
Gene NameihfB; aka: himD; Locus:BWG_0764
Protein NameIntegration host factor subunit beta
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRT GRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review