VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCR
ASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHM
DPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRP
RVMA.
IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution IL17E should be stored at 4oC between 2-7 days and for future use below -18oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please avoid multiple freeze-thaw cycles.
IL-25, IL-17E, IL17E, IL25, Interleukin-25.
