$148.20Catalog Number: PYT253-10ugSize: 10ug

IL 1 alpha Human

Interleukin-1 alpha Human Recombinant

Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.
The IL-1A is purified by proprietary chromatographic techniques.

Accession

P01583

Amino acid sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.

Biological Activity

The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1,000MIU/mg.

Formulation

The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Tris-HCL, pH=8, 5mM MgCl2 and 10% glycerol.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Protein content

Protein quantitation was carried out by two independent methods
1. UV spectroscopy at 280 nm using the absorbency value of 1.13 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).

2. Analysis by RP-HPLC, using a standard solution of IL-1 as a Reference Standard.

Purity

Greater than 98.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility

It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source

Escherichia Coli.

Stability

Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution IL-1a should be stored at 4oC between 2-7 days and for future use below -18oC.
Please avoid multiple freeze-thaw cycles.

Synonyms

Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha,IL1, IL-1A, IL1F1.

Quantity

$148.20

ReviewsWrite Review