Request QuoteCatalog Number: xP323276RASize: 0.2-1mg

Request Quote

Recombinant Ig lambda-2 chain C region

Recombinant Ig lambda-2 chain C region can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP323276RAYeast1mgQuote
EP323276RAE. coli1mgQuote
BP323276RABaculovirus200ugQuote
MP323276RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP20767
Gene Name
Protein NameIg lambda-2 chain C region
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceQPKSTPTLTVFPPSTEELQGNKATLVCLISDFYPSDVEVAWKANGAPISQGVDTANPTKQ GNKYIASSFLRLTAEQWRSRNSFTCQVTHEGNTVEKSLSPAECV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review