Request QuoteCatalog Number: xP302150HUSize: 0.2-1mg

Request Quote

Recombinant Ig gamma lambda chain V-II region DOT

Recombinant Ig gamma lambda chain V-II region DOT can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP302150HUYeast1mgQuote
EP302150HUE. coli1mgQuote
BP302150HUBaculovirus200ugQuote
MP302150HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP80422
Gene Name
Protein NameIg gamma lambda chain V-II region DOT
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceASALTQPRSLSGSPGQAVTISCTGLPSVVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGV PNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYIFVFGQGTDLTVLG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review