Request QuoteCatalog Number: xP302828ENVSize: 0.2-1mg

Request Quote

Recombinant 5-hydroxyisourate hydrolase (hiuH)

Recombinant 5-hydroxyisourate hydrolase (hiuH) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP302828ENVYeast1mgQuote
EP302828ENVE. coli1mgQuote
BP302828ENVBaculovirus200ugQuote
MP302828ENVMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12)
UniProt IDP76341
Gene NamehiuH; aka: yedX; Locus:b1970, JW1953
Protein Name5-hydroxyisourate hydrolase
Region Expressed24-137
Expression Tag6xHis
Purity>90%
AA SequenceAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTG DYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review