$1,194.00Catalog Number: BXP1055-2Size: 20 ug each

Human IRAK4, set of 2

Human IRAK4 Xpress Clones

Interleukin-1 receptor-associated kinases (IRAK), identified as a serine/threonine kinases coprecipitated with IL-1 receptor (IL-1R) in an IL-1 inducible manner, share significant homology to pelle. The mammalian family of IRAK consists of two active kinases, IRAK-1 and IRAK-4; and two inactive kinases, IRAK-2 and IRAK-M. They are implicated in the TLR/IL-1R pathway to both IKK and MAPKs activation, leading to the activation of transcription factors like NF-kB and AP-1.

Human IRAK-4 gene (AF445802) encodes a protein of 52kDa, linked to Ptk9. Northern blots show its expression predominantly in kidney and liver samples, although RT-PCR show low level expression in multiple tissues. Like other IRAKs, IRAK-4 is a multidomain protein, consisting of N-terminal death domain (DD) and a central kinase domain (KD) but lacks the long uniques C-terminal domain. Mutation in the ATP binding pocket, KK213AA renders the enzyme catalytically inactive. In contrast to kinase deficient IRAK-1-KD, which is still able to activate NF-kB and does not inhibit IL-1-dependent signaling, kinase deficient IRAK-4-KK213AA strongly diminished IL-1-induced NF-kB activation suggesting a biological function of the kinase domain in the signal transduction pathways.

Gene Name: Homo sapiens interleukin-1 receptor-associated kinase 4.

Includes and available separately

BXP1055-2:20 ug each
BXP1055-wt:20 ug
BXP1055-ka:20 ug

Custom size is also available upon request.

Specifications

Materials Provided:20 ug transfection ready plasmids in 40ul TE buffer.
Antibiotic Selections:Kan/Neo for kanamycin selectin in bacteria and G418 selection in mammalian cells
Cloning vector:pMEV-2HA
5' cloning site:Bam HI
3' cloning site:Bam HI
GenBank#:AF445802
Mutations:KK213AA

Maintenance of plasmid clones

Upon receiving of the plasmids, briefly spin the vials to collect contents to the bottom before storing at 2-8oC if will be used shortly, or -20 oC for long term storage. It is recommended that you propagate the vectors in E. coli strains that are recombinant deficient (recA) and endonuclease A-deficient (endA) (e.g. DH5α or XL1-Blue).

Human IRAK4 protein sequence

MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPREAATV
AQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTRFHSFSFHELKSITNNF
DEQPASAGGNRMGEGGFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEIKVMATC
QHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCLDGTPPLSWHTRCKVAQGTANGIR
FLHENHHIHRDIKSANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKEEIEDEEKTIEDYTDEKMSD
ADPASVEAMYSAASQCLHEKKNRRPDIAKVQQLLQEMSA

Human IRAK4 nucleotide sequence

atgaacaagc cgttgacacc atcgacatac atacgcaacc ttaatgtggg
gatccttagg aagctgtcgg attttattga tcctcaagaa gggtggaaga
aattagcagt agctatcaaa aagccgtccg gcgacgacag atacaatcag
ttccatataa ggagattcga agccttactt cagaccggga agagccccac
ctgtgaactg ctgtttgact ggggcaccac gaactgcaca gttggcgacc
ttgtggatct actggtccag attgagctgt ttgcccccgc cactctcctg
ctgccggatg ccgttcccca aaccgtcaaa agcctgcctc ctagagaagc
ggcaacagtg gcacaaacac acgggccttg tcaggaaaag gacaggacat
ccgtaatgcc tatgccgaag ctagaacaca gctgcgagcc accggactcc
tcaagcccag acaacagaag tgtagagtcc agcgacactc ggttccacag
cttctcgttc catgaactga agagcatcac aaacaacttc gacgagcaac
ccgcgtctgc cggtggcaac cggatgggag aggggggatt tggagtggtg
tacaagggct gtgtgaacaa caccatcgtg gcggtgaaga agctcggagc
gatggttgaa atcagtactg aagaactaaa gcaacagttt gatcaagaaa
ttaaagtaat ggcaacgtgt cagcacgaga acctggtgga gctgctcggc
ttctccagcg acagcgacaa cctgtgctta gtgtatgctt acatgcccaa
cgggtccttg ctggacagac tgtcctgcct ggatggtaca ccaccgcttt
cctggcacac aaggtgcaag gttgctcagg ggacagcaaa tggcatcagg
tttctgcatg aaaatcatca cattcataga gatattaaaa gtgcaaatat
cttactagac aaagacttta ctgccaaaat atctgacttt gggcttgcac
gggcttcggc aaggctagcg cagacggtca tgaccagccg aatcgtgggc
acaacggctt acatggcacc cgaagctttg cggggagaaa taacacccaa
atctgacatc tacagcttcg gcgtggttct gttggagctg ataaccgggc
tggcggctgt ggatgaaaac cgtgaacctc aactactgct ggatattaaa
gaagagattg aagatgaaga gaagacgatt gaagattaca cggatgagaa
gatgagcgat gcggaccctg cttcggtgga agcaatgtac tctgctgcta
gccagtgtct gcatgagaag aaaaacagac ggccagacat tgcaaaggtt
caacagctgc tacaagagat gtctgcttaa

About Xpress Clones

Xpress Clones are a collection of expression verified genes, including protein kinase genes, dominant negative mutants, consititutively active mutants and kinase deficient mutants, and other expression ready genes. Unlike other collections aiming to have more genes, we focus on the genes important to your research, the mutations with a meaning to your experiment.
If your gene of interest is not in our list, please let us know and we can clone the genes with desired mutant forms, expression verified in the organism you choose.

Quantity

$1,194.00

ReviewsWrite Review