Request QuoteCatalog Number: xP340571EKFSize: 0.2-1mg

Request Quote

Recombinant Histone H4.1 (hhfA)

Recombinant Histone H4.1 (hhfA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340571EKFYeast1mgQuote
EP340571EKFE. coli1mgQuote
BP340571EKFBaculovirus200ugQuote
MP340571EKFMammalian Cell200ugQuote

Protein Information

SpeciesEmericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
UniProt IDP23750
Gene NamehhfA; ORFs:AN0734
Protein NameHistone H4.1
Region Expressed2-103
Expression Tag6xHis
Purity>90%
AA SequenceSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKT FLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review