Request QuoteCatalog Number: xP301736CHSize: 0.2-1mg

Request Quote

Recombinant Histone H4 type VIII (H4-VIII)

Recombinant Histone H4 type VIII (H4-VIII) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP301736CHYeast1mgQuote
EP301736CHE. coli1mgQuote
BP301736CHBaculovirus200ugQuote
MP301736CHMammalian Cell200ugQuote

Protein Information

SpeciesGallus gallus (Chicken)
UniProt IDP70081
Gene NameH4-VIII
Protein NameHistone H4 type VIII
Region Expressed2-103
Expression Tag6xHis
Purity>90%
AA SequenceSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQERTLYGFGG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review