Request QuoteCatalog Number: xP350359HUSize: 0.2-1mg

Request Quote

Recombinant HERV-K_12q14.1 provirus Rec protein

Recombinant HERV-K_12q14.1 provirus Rec protein can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP350359HUYeast1mgQuote
EP350359HUE. coli1mgQuote
BP350359HUBaculovirus200ugQuote
MP350359HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP61571
Gene Name
Protein NameHERV-K_12q14.1 provirus Rec protein
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMHPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEQMKLPSTKKAEPPTWAQLKKLTQLAT KYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETATIENGP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review