Request QuoteCatalog Number: xP010161HUSize: 0.2-1mg

Request Quote

Recombinant Hepatitis B virus X-interacting protein (HBXIP)

Recombinant Hepatitis B virus X-interacting protein (HBXIP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP010161HUYeast1mgQuote
EP010161HUE. coli1mgQuote
BP010161HUBaculovirus200ugQuote
MP010161HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO43504
Gene NameHBXIP; aka: XIP
Protein NameHepatitis B virus X-interacting protein
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPT DIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review