Request QuoteCatalog Number: xP015057DILSize: 0.2-1mg

Request Quote

Recombinant Growth/differentiation factor 8 (mstnb)

Recombinant Growth/differentiation factor 8 (mstnb) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP015057DILYeast1mgQuote
EP015057DILE. coli1mgQuote
BP015057DILBaculovirus200ugQuote
MP015057DILMammalian Cell200ugQuote

Protein Information

SpeciesDanio rerio (Zebrafish) (Brachydanio rerio)
UniProt IDO42222
Gene Namemstnb; aka: gdf8, mstn, mstn-1; ORFs:si:ch211-3o3.2
Protein NameGrowth/differentiation factor 8
Region Expressed266-374
Expression Tag6xHis
Purity>90%
AA SequenceDSGLDCDENSSESRCCRYPLTVDFEDFGWDWIIAPKRYKANYCSGECDYMYLQKYPHTHL VNKASPRGTAGPCCTPTKMSPINMLYFNGKEQIIYGKIPSMVVDRCGCS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review