Request QuoteCatalog Number: xP005293EMOSize: 0.2-1mg

Request Quote

Recombinant Glycoprotein hormones alpha chain (CGA)

Recombinant Glycoprotein hormones alpha chain (CGA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP005293EMOYeast1mgQuote
EP005293EMOE. coli1mgQuote
BP005293EMOBaculovirus200ugQuote
MP005293EMOMammalian Cell200ugQuote

Protein Information

SpeciesEquus burchelli (Plains zebra) (Equus quagga)
UniProt IDO46642
Gene NameCGA
Protein NameGlycoprotein hormones alpha chain
Region Expressed25-120
Expression Tag6xHis
Purity>90%
AA SequenceFPDGEFTTQDCPECKLKVNKYFSKLGVPIYQCMGCCFSRAYPTPARSRKTMLVPKNITSE ATCCVAKAFIRVTLMGNIRLENHTQCYCSTCYHHKI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review