Request QuoteCatalog Number: xP005293RASize: 0.2-1mg

Request Quote

Recombinant Glycoprotein hormones alpha chain (Cga)

Recombinant Glycoprotein hormones alpha chain (Cga) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP005293RAYeast1mgQuote
EP005293RAE. coli1mgQuote
BP005293RABaculovirus200ugQuote
MP005293RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP11962
Gene NameCga; aka: Cga1
Protein NameGlycoprotein hormones alpha chain
Region Expressed25-120
Expression Tag6xHis
Purity>90%
AA SequenceLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSE ATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review