Request QuoteCatalog Number: xP009335DSBSize: 0.2-1mg

Request Quote

Recombinant Glycine cleavage system H protein (gcvH)

Recombinant Glycine cleavage system H protein (gcvH) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP009335DSBYeast1mgQuote
EP009335DSBE. coli1mgQuote
BP009335DSBBaculovirus200ugQuote
MP009335DSBMammalian Cell200ugQuote

Protein Information

SpeciesChlamydia trachomatis (strain D/UW-3/Cx)
UniProt IDO84284
Gene NamegcvH; aka: gcsH; Locus:CT_282
Protein NameGlycine cleavage system H protein
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMKGKKYYSDYHVWIEPIHSRIVKLGLSSQMREHLGNILHIDLPSLGAFIKEGEKLCILES SKSAIEVLSPVSGEVLEVNTALEDDILPVNNATESEGWFVVLQLTEDFRSESFSLEP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review