Request QuoteCatalog Number: xP009335RKLSize: 0.2-1mg

Request Quote

Recombinant Glycine cleavage system H protein (gcvH)

Recombinant Glycine cleavage system H protein (gcvH) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP009335RKLYeast1mgQuote
EP009335RKLE. coli1mgQuote
BP009335RKLBaculovirus200ugQuote
MP009335RKLMammalian Cell200ugQuote

Protein Information

SpeciesRhizobium etli (strain CIAT 652)
UniProt IDB3PP19
Gene NamegcvH; Locus:RHECIAT_CH0002351
Protein NameGlycine cleavage system H protein
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMLKFTAEHEWLELDGDVATVGITTYAVEQLGDLVFVELPEVGKSFSKNDDAATVESVKAA SEVYCPLDGEITAVNDAIVADPSLINSDPQGAGWFFKLKLKNRADADGLLDEAAYKELIA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review