Request QuoteCatalog Number: xP341041FADSize: 0.2-1mg

Request Quote

Recombinant Gag polyprotein (gag)

Recombinant Gag polyprotein (gag) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP341041FADYeast1mgQuote
EP341041FADE. coli1mgQuote
BP341041FADBaculovirus200ugQuote
MP341041FADMammalian Cell200ugQuote

Protein Information

SpeciesFBR murine osteosarcoma virus (FBR-MSV) (Finkel-Biskis-Reilly murine osteosarcoma virus)
UniProt IDP29175
Gene Namegag
Protein NameGag polyprotein
Region Expressed215-310
Expression Tag6xHis
Purity>90%
AA SequencePLRLGGNGQKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLE ARKAVRGNDGRPTQMPNEVNAAFPLERPDWDYTTPE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review