Request QuoteCatalog Number: xP520574ERCSize: 0.2-1mg

Request Quote

Recombinant Flagellar transcriptional regulator FlhD (flhD)

Recombinant Flagellar transcriptional regulator FlhD (flhD) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520574ERCYeast1mgQuote
EP520574ERCE. coli1mgQuote
BP520574ERCBaculovirus200ugQuote
MP520574ERCMammalian Cell200ugQuote

Protein Information

SpeciesPantoea ananatis (strain LMG 20103)
UniProt IDD4GGV4
Gene NameflhD; Locus:PANA_2234
Protein NameFlagellar transcriptional regulator FlhD
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMGTSELLKHIYDINLSYLLLAQRLINQEKASAMFRLGIDEKMADALSELTLPEMVKLAET NQLVCQFRFTDSTVINRLTQESRVDDLQQIHTGILLSSRLLRSASKDAAPTKKRAV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review