Request QuoteCatalog Number: xP304344ENVSize: 0.2-1mg

Request Quote

Recombinant Flagellar protein flhE (flhE)

Recombinant Flagellar protein flhE (flhE) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP304344ENVYeast1mgQuote
EP304344ENVE. coli1mgQuote
BP304344ENVBaculovirus200ugQuote
MP304344ENVMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12)
UniProt IDP76297
Gene NameflhE; Locus:b1878, JW1867
Protein NameFlagellar protein flhE
Region Expressed17-130
Expression Tag6xHis
Purity>90%
AA SequenceAGEGMWQASSVGITLNHRGESMSSAPLSTRQPASGLMTLVAWRYQLIGPTPSGLRVRLCS QSRCVELEGQSGTTVAFSGIAAAEPLRFIWEVPGGGRLIPPLKVQRNEVIVNYR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review