Request QuoteCatalog Number: xP300605ENVSize: 0.2-1mg

Request Quote

Recombinant Ferredoxin-like protein ydiT (ydiT)

Recombinant Ferredoxin-like protein ydiT (ydiT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP300605ENVYeast1mgQuote
EP300605ENVE. coli1mgQuote
BP300605ENVBaculovirus200ugQuote
MP300605ENVMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12)
UniProt IDP77714
Gene NameydiT; Locus:b1700, JW1690
Protein NameFerredoxin-like protein ydiT
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMSQNATVNVDIKLGVNKFHVDEGHPHIILAENPDINEFHKLMKACPAGLYKQDDAGNIHF DSAGCLECGTCRVLCGNTILEQWQYPAGTFGIDFRYG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review