Request QuoteCatalog Number: xP522143RLDSize: 0.2-1mg

Request Quote

Recombinant Ferredoxin-2 (fdxA)

Recombinant Ferredoxin-2 (fdxA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522143RLDYeast1mgQuote
EP522143RLDE. coli1mgQuote
BP522143RLDBaculovirus200ugQuote
MP522143RLDMammalian Cell200ugQuote

Protein Information

SpeciesRhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
UniProt IDD5AP15
Gene NamefdxA; Locus:RCAP_rcc02791
Protein NameFerredoxin-2
Region Expressed2-112
Expression Tag6xHis
Purity>90%
AA SequenceTYVVTDNCIACKYTDCVEVCPVDCFYEGENTLVIHPDECIDCGVCEPECPADAIRPDTEP GMEDWVEFNRTYASQWPVITIKKDPMPDHKKYDGETGKREKYFSPNPGTGD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review