Request QuoteCatalog Number: xP007503HUSize: 0.2-1mg

Request Quote

Recombinant Eukaryotic translation initiation factor 1 (EIF1)

Recombinant Eukaryotic translation initiation factor 1 (EIF1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP007503HUYeast1mgQuote
EP007503HUE. coli1mgRP051144h
BP007503HUBaculovirus200ugQuote
MP007503HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP41567
Gene NameEIF1; aka: SUI1
Protein NameEukaryotic translation initiation factor 1
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review