Request QuoteCatalog Number: xP007563MOSize: 0.2-1mg

Request Quote

Recombinant Eukaryotic translation initiation factor 4E-binding protein 2 (Eif4ebp2)

Recombinant Eukaryotic translation initiation factor 4E-binding protein 2 (Eif4ebp2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP007563MOYeast1mgQuote
EP007563MOE. coli1mgQuote
BP007563MOBaculovirus200ugQuote
MP007563MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP70445
Gene NameEif4ebp2
Protein NameEukaryotic translation initiation factor 4E-binding protein 2
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLL DRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review